PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_19693_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 179aa    MW: 20651.1 Da    PI: 10.6321
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_19693_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-4156133178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Neem_19693_f_1  56 RCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQ 133
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-3650118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.26554131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.12E-3955134IPR004333Transcription factor, SBP-box
PfamPF031102.7E-3157130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
FVIPKTEEVS RPTDFASRIG LNLGGRTYFS SADDDFVNRL YRRPRPGEPG SSNIPRCQAE  60
GCNADLTHAK HYHRRHKVCE FHSKASTVIA AGLTQRFCQQ CSRFHLLSEF DNGKRSCRKR  120
LADHNRRRRK SQQQQQPAQD NQKSHQLESA RNSPSENLAR KIEGREDAAV MRSPTWRLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3447130184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445347.13e-93hypothetical protein CICLE_v10021106mg
RefseqXP_006445349.19e-94hypothetical protein CICLE_v10021106mg
SwissprotQ8GXL37e-77SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A067HCP39e-94A0A067HCP3_CITSI; Uncharacterized protein
TrEMBLV4VYP09e-94V4VYP0_9R
TrEMBLV4TYA73e-93V4TYA7_9R
STRINGVIT_15s0021g02300.t012e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-72squamosa promoter binding protein-like 8